HMGCS1 (NM_002130) Human Recombinant Protein

CAT#: TP310090

Recombinant protein of human 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble) (HMGCS1), transcript variant 2

Product Images

Coomassie blue staining of purified HMGCS1 protein (Cat# TP310090). The protein was produced from HEK293T cells transfected with HMGCS1 cDNA clone (Cat# RC210090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210090 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCM
  TVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAV
  NWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDML
  SEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLL
  NDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVY
  GSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP
  DVFAENMKLREDTYHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIAT
  EHIPSPAKKVPRLPATAAEPEAAVISNGEH
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 57.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002121
• Locus ID: 3157
• UniProt ID: Q01581, A0A024R059
• Cytogenetics: 5p12
• Refseq Size: 5391
• Refseq ORF: 1560
• Synonyms: HMGCS
• Summary: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Valine, leucine and isoleucine degradation