HESX1 (NM_003865) Human Recombinant Protein

CAT#: TP310107

Recombinant protein of human HESX homeobox 1 (HESX1)

Product Images

Coomassie blue staining of purified HESX1 protein (Cat# TP310107). The protein was produced from HEK293T cells transfected with HESX1 cDNA clone (Cat# RC210107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGIS
  FPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIRED
  LAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003856
• Locus ID: 8820
• UniProt ID: Q9UBX0, A1LQR0
• Cytogenetics: 3p14.3
• Refseq Size: 1182
• Refseq ORF: 555
• Synonyms: ANF; CPHD5; RPX
• Summary: This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors