FGF 23 (FGF23) (NM_020638) Human Recombinant Protein

CAT#: TP310127

Recombinant protein of human fibroblast growth factor 23 (FGF23)

Product Images

Coomassie blue staining of purified FGF23 protein (Cat# TP310127). The protein was produced from HEK293T cells transfected with FGF23 cDNA clone (Cat# RC210127) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210127 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY
  SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR
  AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL
  PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065689
• Locus ID: 8074
• UniProt ID: Q9GZV9
• Cytogenetics: 12p13.32
• Refseq Size: 3018
• Refseq ORF: 753
• Synonyms: ADHR; FGFN; HFTC2; HPDR2; HYPF; PHPTC
• Summary: This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton