MARCKS (NM_002356) Human Recombinant Protein

CAT#: TP310277

Recombinant protein of human myristoylated alanine-rich protein kinase C substrate (MARCKS)

Product Images

Coomassie blue staining of purified MARCKS protein (Cat# TP310277). The protein was produced from HEK293T cells transfected with MARCKS cDNA clone (Cat# RC210277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210277 representing NM_002356
  Red=Cloning site Green=Tags(s)
  
  MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKE
  EPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAED
  GATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAA
  SGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACE
  APSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Binding assay (PMID: 25863174)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002347
• Locus ID: 4082
• UniProt ID: P29966, Q6NVI1
• Cytogenetics: 6q21
• Refseq Size: 2589
• Refseq ORF: 996
• Synonyms: 80K-L; MACS; PKCSL; PRKCSL
• Summary: The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Fc gamma R-mediated phagocytosis