GMFG (NM_004877) Human Recombinant Protein

CAT#: TP310289

Recombinant protein of human glia maturation factor, gamma (GMFG)

Product Images

Coomassie blue staining of purified GMFG protein (Cat# TP310289). The protein was produced from HEK293T cells transfected with GMFG cDNA clone (Cat# RC210289) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210289 representing NM_004877
  Red=Cloning site Green=Tags(s)
  
  MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVV
  YSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSF
  FR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004868
• Locus ID: 9535
• UniProt ID: O60234
• Cytogenetics: 19q13.2
• Refseq Size: 561
• Refseq ORF: 426
• Synonyms: GMF-GAMMA