CCN4 (NM_003882) Human Recombinant Protein
CAT#: TP310402
Recombinant protein of human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210402 protein sequence
Red=Cloning site Green=Tags(s) MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNC KYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVE AWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPE ASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPN DIFADLESYPDFSEIAN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003873 |
| Locus ID | 8840 |
| UniProt ID | O95388 |
| Cytogenetics | 8q24.22 |
| Refseq Size | 5194 |
| Refseq ORF | 1101 |
| Synonyms | WISP1; WISP1-OT1; WISP1-UT1; WISP1c; WISP1i; WISP1tc |
| Summary | This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase. It is 83% identical to the mouse protein at the amino acid level. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Mar 2011] |
| Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - Wnt Signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403320 | WISP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418374 | WISP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403320 | Transient overexpression lysate of WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 2 |
USD 436.00 |
|
| LY418374 | Transient overexpression lysate of WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1 |
USD 436.00 |
|
| PH310402 | WISP1 MS Standard C13 and N15-labeled recombinant protein (NP_003873) |
USD 2,055.00 |
|
| TP723479 | Purified recombinant protein of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1. |
USD 240.00 |
|
| TP761856 | Purified recombinant protein of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China