TRIT1 (NM_017646) Human Recombinant Protein
CAT#: TP310476
Recombinant protein of human tRNA isopentenyltransferase 1 (TRIT1)
View other "TRIT1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210476 protein sequence
Red=Cloning site Green=Tags(s) MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKV SAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQ EMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEE GGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIF QSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVS DVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060116 |
Locus ID | 54802 |
UniProt ID | Q9H3H1, Q3T7C7, Q53F11 |
Cytogenetics | 1p34.2 |
Refseq Size | 2146 |
Refseq ORF | 1401 |
Synonyms | COXPD35; GRO1; hGRO1; IPPT; IPT; IPTase; MOD5 |
Summary | This gene encodes a protein that that is targeted to the mitochondrion and modifies transfer RNAs (tRNAs) by adding a dimethylallyl group onto the adenine at position 37. This modification is important for maintaining the correct reading frame during protein translation. This gene is considered a tumor suppressor and its expression can decrease cell growth. Alternative splicing results in multiple transcripts variants, most of which are likely non-functional. [provided by RefSeq, Aug 2015] |
Protein Pathways | Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413645 | TRIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413645 | Transient overexpression lysate of tRNA isopentenyltransferase 1 (TRIT1) |
USD 396.00 |
|
PH310476 | TRIT1 MS Standard C13 and N15-labeled recombinant protein (NP_060116) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review