CGRP (CALCB) (NM_000728) Human Recombinant Protein
CAT#: TP310496
Recombinant protein of human calcitonin-related polypeptide beta (CALCB)
View other "CALCB" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210496 protein sequence
Red=Cloning site Green=Tags(s) MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000719 |
Locus ID | 797 |
UniProt ID | P10092 |
Cytogenetics | 11p15.2 |
Refseq Size | 1031 |
Refseq ORF | 381 |
Synonyms | CALC2; CGRP-II; CGRP2 |
Summary | CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424540 | CALCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424540 | Transient overexpression lysate of calcitonin-related polypeptide beta (CALCB) |
USD 396.00 |
|
PH310496 | CALCB MS Standard C13 and N15-labeled recombinant protein (NP_000719) |
USD 2,055.00 |
|
TP721150 | Purified recombinant protein of Human calcitonin-related polypeptide beta (CALCB) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review