CGRP (CALCB) (NM_000728) Human Recombinant Protein

CAT#: TP310496

Recombinant protein of human calcitonin-related polypeptide beta (CALCB)

Product Images

Coomassie blue staining of purified CALCB protein (Cat# TP310496). The protein was produced from HEK293T cells transfected with CALCB cDNA clone (Cat# RC210496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210496 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE
  TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000719
• Locus ID: 797
• UniProt ID: P10092
• Cytogenetics: 11p15.2
• Refseq Size: 1031
• Refseq ORF: 381
• Synonyms: CALC2; CGRP-II; CGRP2
• Summary: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein