CGRP (CALCB) (NM_000728) Human Recombinant Protein

CAT#: TP721150

Purified recombinant protein of Human calcitonin-related polypeptide beta (CALCB)

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMGFRKFSPFLALSILVLYQAG
• Tag: N-GST
• Predicted MW: 40.9 kDa
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 3 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000719
• Locus ID: 797
• UniProt ID: P10092
• Cytogenetics: 11p15.2
• Refseq Size: 1031
• Refseq ORF: 381
• Synonyms: CALC2; CGRP-II; CGRP2
• Summary: ''
• Protein Families: Druggable Genome, Secreted Protein