C18orf32 (NM_001035005) Human Recombinant Protein
CAT#: TP310558
Recombinant protein of human chromosome 18 open reading frame 32 (C18orf32)
View other "C18orf32" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210558 protein sequence
Red=Cloning site Green=Tags(s) MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEI CDKKKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001030177 |
Locus ID | 497661 |
UniProt ID | Q8TCD1 |
Cytogenetics | 18q21.1 |
Refseq Size | 1669 |
Refseq ORF | 228 |
Summary | May activate the NF-kappa-B signaling pathway.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422122 | C18orf32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422122 | Transient overexpression lysate of chromosome 18 open reading frame 32 (C18orf32) |
USD 396.00 |
|
PH310558 | C18orf32 MS Standard C13 and N15-labeled recombinant protein (NP_001030177) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review