Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Recombinant Protein
CAT#: TP310613
Purified recombinant protein of Homo sapiens mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210613 representing NM_170738
Red=Cloning site Green=Tags(s) MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAG IEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAA FQKERAIFLAAQKEADLAAQEEAAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733934 |
Locus ID | 65003 |
UniProt ID | Q9Y3B7 |
Cytogenetics | 11q13.2 |
Refseq Size | 762 |
Refseq ORF | 498 |
Synonyms | CGI-113; L11MT; MRP-L11 |
Summary | This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406858 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC414217 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430317 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406858 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY414217 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY430317 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
PH300033 | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_057134) |
USD 2,055.00 |
|
PH310613 | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) |
USD 2,055.00 |
|
TP300033 | Recombinant protein of human mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review