Germany
Japan
United Kingdom
China
Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Recombinant Protein
CAT#: TP310613
Purified recombinant protein of Homo sapiens mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210613 representing NM_170738
Red=Cloning site Green=Tags(s) MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAG IEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAA FQKERAIFLAAQKEADLAAQEEAAKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_733934 |
| Locus ID | 65003 |
| UniProt ID | Q9Y3B7 |
| Cytogenetics | 11q13.2 |
| Refseq Size | 762 |
| Refseq ORF | 498 |
| Synonyms | CGI-113; L11MT; MRP-L11 |
| Summary | This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406858 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC414217 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC430317 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LY406858 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
| LY414217 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
| LY430317 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
| PH300033 | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_057134) |
USD 2,055.00 |
|
| PH310613 | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) |
USD 2,055.00 |
|
| TP300033 | Recombinant protein of human mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
