Lactate Dehydrogenase C (LDHC) (NM_017448) Human Recombinant Protein
CAT#: TP310627
Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210627 protein sequence
Red=Cloning site Green=Tags(s) MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059144 |
Locus ID | 3948 |
UniProt ID | P07864, A0A140VKA7 |
Cytogenetics | 11p15.1 |
Refseq Size | 1264 |
Refseq ORF | 996 |
Synonyms | CT32; LDH3; LDHX |
Summary | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400837 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC413747 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400837 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 |
USD 396.00 |
|
LY413747 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 |
USD 396.00 |
|
PH309516 | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292) |
USD 2,055.00 |
|
PH310627 | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144) |
USD 2,055.00 |
|
TP309516 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review