NOSTRIN (NM_001039724) Human Recombinant Protein
CAT#: TP310661
Recombinant protein of human nitric oxide synthase trafficker (NOSTRIN), transcript variant 2
View other "NOSTRIN" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210661 protein sequence
Red=Cloning site Green=Tags(s) MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAA YVEELPSNAGNTATKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034813 |
Locus ID | 115677 |
UniProt ID | Q8IVI9 |
Cytogenetics | 2q24.3 |
Refseq Size | 1947 |
Refseq ORF | 1518 |
Synonyms | DaIP2 |
Summary | Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.[supplied by OMIM, Apr 2004] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403273 | NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421819 | NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403273 | Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 1 |
USD 396.00 |
|
LY421819 | Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 2 |
USD 396.00 |
|
PH310661 | NOSTRIN MS Standard C13 and N15-labeled recombinant protein (NP_001034813) |
USD 2,055.00 |
|
TP760542 | Purified recombinant protein of Human nitric oxide synthase trafficker (NOSTRIN), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review