WW domain binding protein 4 (WBP4) (NM_007187) Human Recombinant Protein

CAT#: TP310721

Recombinant protein of human WW domain binding protein 4 (formin binding protein 21) (WBP4)

Product Images

Coomassie blue staining of purified WBP4 protein (Cat# TP310721). The protein was produced from HEK293T cells transfected with WBP4 cDNA clone (Cat# RC210721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA
  AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY
  YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN
  ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS
  NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD
  GVAPVFKKRRTENGKSRNLRQRGDDQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009118
• Locus ID: 11193
• UniProt ID: O75554
• Cytogenetics: 13q14.11
• Refseq Size: 2354
• Refseq ORF: 1128
• Synonyms: FBP21
• Summary: This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeq, Jul 2008]