ERP29 (NM_006817) Human Recombinant Protein

CAT#: TP310918

Recombinant protein of human endoplasmic reticulum protein 29 (ERP29), transcript variant 1

Product Images

Coomassie blue staining of purified ERP29 protein (Cat# TP310918). The protein was produced from HEK293T cells transfected with ERP29 cDNA clone (Cat# RC210918) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210918 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ
  DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA
  IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL
  DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006808
• Locus ID: 10961
• UniProt ID: P30040, V9HW71
• Cytogenetics: 12q24.13
• Refseq Size: 1472
• Refseq ORF: 783
• Synonyms: C12orf8; ERp28; ERp31; HEL-S-107; PDI-DB; PDIA9
• Summary: This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
• Protein Families: Transmembrane