SDR O (SDR9C7) (NM_148897) Human Recombinant Protein

CAT#: TP310941

Recombinant protein of human short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7)

Product Images

Coomassie blue staining of purified SDR9C7 protein (Cat# TP310941). The protein was produced from HEK293T cells transfected with SDR9C7 cDNA clone (Cat# RC210941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210941 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS
  YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV
  TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL
  GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG
  LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_683695
• Locus ID: 121214
• UniProt ID: Q8NEX9
• Cytogenetics: 12q13.3
• Refseq Size: 1765
• Refseq ORF: 939
• Synonyms: ARCI13; RDHS; SDR-O; SDRO
• Summary: This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. [provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome