WFDC6 (NM_080827) Human Recombinant Protein

CAT#: TP310952

Recombinant protein of human WAP four-disulfide core domain 6 (WFDC6)

Product Images

Coomassie blue staining of purified WFDC6 protein (Cat# TP310952). The protein was produced from HEK293T cells transfected with WFDC6 cDNA clone (Cat# RC210952) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210952 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL
  DFRKVSLTLYHKEELE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_543017
• Locus ID: 140870
• UniProt ID: Q9BQY6, A0A0K0K1K0
• Cytogenetics: 20q13.12
• Refseq Size: 619
• Refseq ORF: 258
• Synonyms: C20orf171; dJ461P17.11; HEL-S-295; WAP6
• Summary: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Read-through transcription exists between this gene and the upstream SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) gene. [provided by RefSeq, Nov 2010]
• Protein Families: Secreted Protein