OTOS (NM_148961) Human Recombinant Protein

CAT#: TP311259

Recombinant protein of human otospiralin (OTOS)

Product Images

Coomassie blue staining of purified OTOS protein (Cat# TP311259). The protein was produced from HEK293T cells transfected with OTOS cDNA clone (Cat# RC211259) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211259 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF
  FAHFPLGSTLGFHVPYQED
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_683764
• Locus ID: 150677
• UniProt ID: Q8NHW6
• Cytogenetics: 2q37.3
• Refseq Size: 566
• Refseq ORF: 267
• Synonyms: OTOSP
• Summary: Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008]
• Protein Families: Secreted Protein