C20orf79 (SCP2D1) (NM_178483) Human Recombinant Protein
CAT#: TP311269
Recombinant protein of human chromosome 20 open reading frame 79 (C20orf79)
View other "SCP2D1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211269 protein sequence
Red=Cloning site Green=Tags(s) MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVF QLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKV LLSWKLERVFKDWAKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848578 |
Locus ID | 140856 |
UniProt ID | Q9UJQ7 |
Cytogenetics | 20p11.23 |
Refseq Size | 677 |
Refseq ORF | 468 |
Synonyms | C20orf79; dJ1068E13.2; HSD22 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405885 | SCP2D1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405885 | Transient overexpression lysate of chromosome 20 open reading frame 79 (C20orf79) |
USD 396.00 |
|
PH311269 | C20orf79 MS Standard C13 and N15-labeled recombinant protein (NP_848578) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review