PCDHGB4 (NM_032098) Human Recombinant Protein
CAT#: TP311321
Recombinant protein of human protocadherin gamma subfamily B, 4 (PCDHGB4), transcript variant 2
View other "PCDHGB4" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211321 protein sequence
Red=Cloning site Green=Tags(s) MGSGAGELGRAERLPVLFLFLLSLFCPALCEQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSS EKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFEL QISESAQPGTRFILGSAHDADIGSNTLQNYQLSPSDHFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHL TLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFS FSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVIDENDNAPEVIFQSL PNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITV TATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIM ASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRV LYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARAL GDRDAVRQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPDPSDLQAELQFYLVVALALISVL FLVAMILAIALRLRRSSSPASWSCFQPGLCVKSESVVPPNYSEGTLPYSYNLCVAHTGKTEFNFLKCSEQ LSSGQDILCGDSSGALFPLCNSSELTSHQVSFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115269 |
Locus ID | 8641 |
UniProt ID | Q9UN71 |
Cytogenetics | 5q31.3 |
Refseq Size | 2412 |
Refseq ORF | 2409 |
Synonyms | CDH20; FIB2; PCDH-GAMMA-B4 |
Summary | This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. This particular family member is expressed in fibroblasts and is thought to play a role in wound healing in response to injury. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410380 | PCDHGB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418461 | PCDHGB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429163 | PCDHGB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY410380 | Transient overexpression lysate of protocadherin gamma subfamily B, 4 (PCDHGB4), transcript variant 2 |
USD 396.00 |
|
LY418461 | Transient overexpression lysate of protocadherin gamma subfamily B, 4 (PCDHGB4), transcript variant 1 |
USD 605.00 |
|
LY429163 | Transient overexpression lysate of protocadherin gamma subfamily B, 4 (PCDHGB4), transcript variant 1 |
USD 605.00 |
|
PH311321 | PCDHGB4 MS Standard C13 and N15-labeled recombinant protein (NP_115269) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review