GDF6 (NM_001001557) Human Recombinant Protein

CAT#: TP311366

Purified recombinant protein of Human growth differentiation factor 6 (GDF6), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein GDF6 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211366 representing NM_001001557
  Red=Cloning site Green=Tags(s)
  
  MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDAGREGQEPQPR
  PQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSH
  TPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLFPCLSPLLLDARTLDPQGAPPA
  GWEVFDVWQGLRHQPWKQLCLELRAAWGELDAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVV
  FTRSQRKNLFAEMREQLGSAEAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKS
  RLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
  VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 50.66 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001001557
• Locus ID: 392255
• UniProt ID: Q6KF10, A0A0S2A5D6
• Cytogenetics: 8q22.1
• Refseq Size: 3716
• Refseq ORF: 1365
• Synonyms: BMP-13; BMP13; CDMP2; KFM; KFS; KFS1; KFSL; SGM1; SYNS4
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene are associated with Klippel-Feil syndrome, microphthalmia, and Leber congenital amaurosis. [provided by RefSeq, Sep 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: TGF-beta signaling pathway