DISC1 (NM_018662) Human Recombinant Protein
CAT#: TP312015
Recombinant protein of human disrupted in schizophrenia 1 (DISC1), transcript variant L
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212015 representing NM_018662
Red=Cloning site Green=Tags(s) MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA AASCMTAGVHEAQA TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 93.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | ELISA binding assay (PMID: 26062786) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061132 |
Locus ID | 27185 |
UniProt ID | Q9NRI5 |
Cytogenetics | 1q42.2 |
Refseq Size | 7069 |
Refseq ORF | 2562 |
Synonyms | C1orf136; SCZD9 |
Summary | This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402701 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC431332 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431372 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431469 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431473 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431560 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY402701 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant L |
USD 495.00 |
|
LY431332 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant q |
USD 325.00 |
|
LY431372 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant m |
USD 325.00 |
|
LY431469 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant l |
USD 325.00 |
|
LY431473 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant k |
USD 325.00 |
|
LY431560 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant f |
USD 495.00 |
|
PH312015 | DISC1 MS Standard C13 and N15-labeled recombinant protein (NP_061132) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review