PDE4D (NM_006203) Human Recombinant Protein
CAT#: TP312410
Recombinant protein of human phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) (PDE4D), transcript variant 2
View other "PDE4D" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212410 representing NM_006203
Red=Cloning site Green=Tags(s) MHVNNFPFRRHSWICFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMS RNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLA SETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIP SPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGN RPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVF TDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKK QRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKP LQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDI LDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKT LCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 76.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006194 |
Locus ID | 5144 |
UniProt ID | Q08499 |
Cytogenetics | 5q11.2-q12.1 |
Refseq Size | 5876 |
Refseq ORF | 2016 |
Synonyms | ACRDYS2; DPDE3; HSPDE4D; PDE4DN2; PDE43; STRK1 |
Summary | This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401868 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC434324 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434368 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401868 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) (PDE4D), transcript variant 2 |
USD 605.00 |
|
LY434324 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 8 |
USD 396.00 |
|
LY434368 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 6 |
USD 605.00 |
|
PH312410 | PDE4D MS Standard C13 and N15-labeled recombinant protein (NP_006194) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review