AMHR2 (NM_020547) Human Recombinant Protein
CAT#: TP312425
Recombinant protein of human anti-Mullerian hormone receptor, type II (AMHR2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212425 representing NM_020547
Red=Cloning site Green=Tags(s) MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQD RAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAA PGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGEPVPEPRPDSGRDWSVELQELPELCFSQQVI REGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVL ELHPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQNGQNKPGIAHRDLSSQNVLIREDGSCAI GDLGLALVLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE ILSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGLRELLEDCWD ADPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACHFSVQQGP CSRNPQPACTLSPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065434 |
Locus ID | 269 |
UniProt ID | Q16671 |
Cytogenetics | 12q13.13 |
Refseq Size | 1855 |
Refseq ORF | 1722 |
Synonyms | AMHR; MISR2; MISRII; MRII |
Summary | This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402792 | AMHR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC431423 | AMHR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402792 | Transient overexpression lysate of anti-Mullerian hormone receptor, type II (AMHR2), transcript variant 1 |
USD 495.00 |
|
LY431423 | Transient overexpression lysate of anti-Mullerian hormone receptor, type II (AMHR2), transcript variant 3 |
USD 325.00 |
|
PH312425 | AMHR2 MS Standard C13 and N15-labeled recombinant protein (NP_065434) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review