RFX5 (NM_001025603) Human Recombinant Protein
CAT#: TP312448
Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212448 representing NM_001025603
Red=Cloning site Green=Tags(s) MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020774 |
Locus ID | 5993 |
UniProt ID | P48382 |
Cytogenetics | 1q21.3 |
Refseq Size | 3611 |
Refseq ORF | 1848 |
Summary | A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Antigen processing and presentation, Primary immunodeficiency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422455 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC424713 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425501 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY422455 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2 |
USD 495.00 |
|
LY424713 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1 |
USD 325.00 |
|
LY425501 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2 |
USD 325.00 |
|
PH312448 | RFX5 MS Standard C13 and N15-labeled recombinant protein (NP_001020774) |
USD 2,055.00 |
|
TP761917 | Purified recombinant protein of Human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1, Leu391-Pro616, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review