DDT (NM_001084392) Human Recombinant Protein

CAT#: TP312637

Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2

Product Images

Coomassie blue staining of purified DDT protein (Cat# TP312637). The protein was produced from HEK293T cells transfected with DDT cDNA clone (Cat# RC212637) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212637 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT
  AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001077861
• Locus ID: 1652
• UniProt ID: P30046, Q53Y51
• Cytogenetics: 22q11.23
• Refseq Size: 637
• Refseq ORF: 354
• Synonyms: D-DT; DDCT; MIF-2; MIF2
• Summary: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]