RASSF7 (NM_003475) Human Recombinant Protein

CAT#: TP312844

Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1

Product Images

Coomassie blue staining of purified RASSF7 protein (Cat# TP312844). The protein was produced from HEK293T cells transfected with RASSF7 cDNA clone (Cat# RC212844) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212844 representing NM_003475
  Red=Cloning site Green=Tags(s)
  
  MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ
  ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG
  PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL
  DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL
  EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA
  ELLEVAAAPAPEWCPLAAQPQAL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003466
• Locus ID: 8045
• UniProt ID: Q02833, A0A024RCE4
• Cytogenetics: 11p15.5
• Refseq Size: 1539
• Refseq ORF: 1119
• Synonyms: C11orf13; CFAP88; FAP88; HRAS1; HRC1
• Summary: Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.[UniProtKB/Swiss-Prot Function]