IKK gamma (IKBKG) (NM_001099856) Human Recombinant Protein
CAT#: TP312996
Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212996 representing NM_001099856
Red=Cloning site Green=Tags(s) MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001093326 |
Locus ID | 8517 |
UniProt ID | Q9Y6K9 |
Cytogenetics | Xq28 |
Refseq Size | 2073 |
Refseq ORF | 1257 |
Synonyms | AMCBX1; EDAID1; FIP-3; FIP3; Fip3p; IKK-gamma; IKKAP1; IKKG; IMD33; IP; IP1; IP2; IPD2; NEMO; ZC2HC9 |
Summary | This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Primary immunodeficiency, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400446 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC401206 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420210 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426094 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428764 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400446 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2 |
USD 605.00 |
|
LY401206 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3 |
USD 396.00 |
|
LY420210 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1 |
USD 605.00 |
|
LY426094 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1 |
USD 396.00 |
|
LY428764 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4 |
USD 396.00 |
|
PH301743 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_003630) |
USD 2,055.00 |
|
PH312996 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093326) |
USD 2,055.00 |
|
PH318044 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093327) |
USD 2,055.00 |
|
PH326825 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001138727) |
USD 2,055.00 |
|
TP301743 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3 |
USD 867.00 |
|
TP318044 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1 |
USD 748.00 |
|
TP326825 | Purified recombinant protein of Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review