IL17RC (NM_153461) Human Recombinant Protein
CAT#: TP313432
Recombinant protein of human interleukin 17 receptor C (IL17RC), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213432 representing NM_153461
Red=Cloning site Green=Tags(s) MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLAPVTAATARTA LSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTE LVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVL LEVQVPAALVQFGQSVGSVVYDCFEAALGSEVQIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWAL PWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLE PDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTS LPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWALVWLACLLFAAALSLILLLK KDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERLVGALASALCQLPLRVAVDLWSRRELSAQGP VAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSY VGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPP GTPAPGRGVGPGAGPGAGDGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 83.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_703191 |
Locus ID | 84818 |
UniProt ID | Q8NAC3 |
Cytogenetics | 3p25.3-p24.1 |
Refseq Size | 2691 |
Refseq ORF | 2373 |
Synonyms | CANDF9; IL17-RL; IL17RL |
Summary | This gene encodes a single-pass type I membrane protein that shares similarity with the interleukin-17 receptor (IL-17RA). Unlike IL-17RA, which is predominantly expressed in hemopoietic cells, and binds with high affinity to only IL-17A, this protein is expressed in nonhemopoietic tissues, and binds both IL-17A and IL-17F with similar affinities. The proinflammatory cytokines, IL-17A and IL-17F, have been implicated in the progression of inflammatory and autoimmune diseases. Multiple alternatively spliced transcript variants encoding different isoforms have been detected for this gene, and it has been proposed that soluble, secreted proteins lacking transmembrane and intracellular domains may function as extracellular antagonists to cytokine signaling. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407040 | IL17RC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC407041 | IL17RC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC409968 | IL17RC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC430274 | IL17RC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY407040 | Transient overexpression lysate of interleukin 17 receptor C (IL17RC), transcript variant 2 |
USD 495.00 |
|
LY407041 | Transient overexpression lysate of interleukin 17 receptor C (IL17RC), transcript variant 1 |
USD 495.00 |
|
LY409968 | Transient overexpression lysate of interleukin 17 receptor C (IL17RC), transcript variant 3 |
USD 495.00 |
|
LY430274 | Transient overexpression lysate of interleukin 17 receptor C (IL17RC), transcript variant 2 |
USD 495.00 |
|
PH313432 | IL17RC MS Standard C13 and N15-labeled recombinant protein (NP_703191) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review