Paxillin (PXN) (NM_002859) Human Recombinant Protein
CAT#: TP313811
Recombinant protein of human paxillin (PXN), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213811 representing NM_002859
Red=Cloning site Green=Tags(s) MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ PSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKFMA QGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVC THCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCE VHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Pull-down assay (PMID: 27184837) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002850 |
| Locus ID | 5829 |
| UniProt ID | P49023 |
| Cytogenetics | 12q24.23 |
| Refseq Size | 3595 |
| Refseq ORF | 1671 |
| Summary | This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties (PMID:9054445). [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401010 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425922 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429750 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401010 | Transient overexpression lysate of paxillin (PXN), transcript variant 2 |
USD 665.00 |
|
| LY425922 | Transient overexpression lysate of paxillin (PXN), transcript variant 1 |
USD 436.00 |
|
| LY429750 | Transient overexpression lysate of paxillin (PXN), transcript variant 3 |
USD 436.00 |
|
| PH313811 | PXN MS Standard C13 and N15-labeled recombinant protein (NP_002850) |
USD 2,055.00 |
|
| TP760834 | Purified recombinant protein of Human paxillin (PXN), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China