PGRPL (PGLYRP2) (NM_052890) Human Recombinant Protein

CAT#: TP315773

Recombinant protein of human peptidoglycan recognition protein 2 (PGLYRP2)

Product Images

In vitro antifungal activity of PGLYRP-2. C. albicans (10,000 CFU) in 400 uL PBS were incubated without or with PGLYRP-2 (OriGene TP315773) in different concentration (1, 10 or 100 ug/ml) at 37 C for 2, 6, 24 hours. At the end of incubation, the samples were subjected to fungal culture and plate-colony counting. Results were presented as colony-forming units (CFU) of C. albicans (mean +- SD) in cultures. Each symbol represents an individual sample, and data are representative of three independent experiments. * p < 0.05. Figure cited from PLoS ONE, PMID: 26039076

• 

  Coomassie blue staining of purified PGLYRP2 protein (Cat# TP315773). The protein was produced from HEK293T cells transfected with PGLYRP2 cDNA clone (Cat# RC215773) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215773 representing NM_052890
  Red=Cloning site Green=Tags(s)
  
  MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL
  LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL
  PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS
  PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV
  ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH
  LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
  DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL
  PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR
  SRREPPPRTLPATDLQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 62 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 26039076)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443122
• Locus ID: 114770
• UniProt ID: Q96PD5
• Cytogenetics: 19p13.12
• Refseq Size: 1901
• Refseq ORF: 1728
• Synonyms: HMFT0141; PGLYRPL; PGRP-L; PGRPL; tagL; tagL-alpha; tagl-beta; TAGL-like
• Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Secreted Protein