CAMK2G (NM_172173) Human Recombinant Protein
CAT#: TP317059
Recombinant protein of human calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 6
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217059 representing NM_172173
Red=Cloning site Green=Tags(s) MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKH PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVG YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVAS MMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLEPQTTVVHNAT DGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDF HKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLN VHYHCSGAPAAPLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_751913 |
| Locus ID | 818 |
| UniProt ID | Q13555 |
| Cytogenetics | 10q22.2 |
| Refseq Size | 3665 |
| Refseq ORF | 1512 |
| Synonyms | CAMK; CAMK-II; CAMKG; MRD59 |
| Summary | The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.[provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406780 | CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406781 | CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420064 | CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY406780 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 2 |
USD 436.00 |
|
| LY406781 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 3 |
USD 436.00 |
|
| LY420064 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 4 |
USD 665.00 |
|
| PH317059 | CAMK2G MS Standard C13 and N15-labeled recombinant protein (NP_751913) |
USD 2,055.00 |
|
| TP761314 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China