SSH3BP1 (ABI1) (NM_005470) Human Recombinant Protein
CAT#: TP317707
Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217707 representing NM_005470
Red=Cloning site Green=Tags(s) MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP IDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVP NDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPAPGSAPG SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSIADSPTPPPPPPPDDIPMF DDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIK KNDDGWYEGVCNRVTGLFPGNYVESIMHYTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005461 |
| Locus ID | 10006 |
| UniProt ID | Q8IZP0 |
| Cytogenetics | 10p12.1 |
| Refseq Size | 3725 |
| Refseq ORF | 1524 |
| Synonyms | ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1 |
| Summary | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401677 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422826 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422828 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425333 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432894 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC433150 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC433176 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401677 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 1 |
USD 665.00 |
|
| LY422826 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 2 |
USD 665.00 |
|
| LY422828 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 4 |
USD 436.00 |
|
| LY425333 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 2 |
USD 396.00 |
|
| LY432894 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 12 |
USD 436.00 |
|
| LY433150 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 6 |
USD 436.00 |
|
| LY433176 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 5 |
USD 436.00 |
|
| PH301264 | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_001012770) |
USD 2,055.00 |
|
| PH317707 | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_005461) |
USD 2,055.00 |
|
| TP301264 | Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 4 |
USD 867.00 |
|
| TP329894 | Purified recombinant protein of Homo sapiens abl-interactor 1 (ABI1), transcript variant 12. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China