Tapasin (TAPBP) (NM_003190) Human Recombinant Protein
CAT#: TP317968
Recombinant protein of human TAP binding protein (tapasin) (TAPBP), transcript variant 1
View other "TAPBP" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217968 representing NM_003190
Red=Cloning site Green=Tags(s) MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHD PAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLR PQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQH LGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQG QVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLS ALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA FLLLGLFKALGWAAVYLSTCKDSKKKAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003181 |
Locus ID | 6892 |
UniProt ID | O15533, A0A024RCT1 |
Cytogenetics | 6p21.32 |
Refseq Size | 3629 |
Refseq ORF | 1344 |
Synonyms | NGS17; TAPA; TPN; TPSN |
Summary | This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406739 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406740 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418843 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY406739 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 2 |
USD 396.00 |
|
LY406740 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 3 |
USD 396.00 |
|
LY418843 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 1 |
USD 605.00 |
|
PH317968 | TAPBP MS Standard C13 and N15-labeled recombinant protein (NP_003181) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review