MYADM (NM_001020818) Human Recombinant Protein

CAT#: TP321290

Purified recombinant protein of Human myeloid-associated differentiation marker (MYADM), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified MYADM protein (Cat# TP321290). The protein was produced from HEK293T cells transfected with MYADM cDNA clone (Cat# RC221290) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221290 representing NM_001020818
  Red=Cloning site Green=Tags(s)
  
  MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF
  TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA
  TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY
  AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS
  RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 35.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001018654
• Locus ID: 91663
• UniProt ID: Q96S97, A0A024R4N0
• Cytogenetics: 19q13.42
• Refseq Size: 3243
• Refseq ORF: 966
• Synonyms: SB135
• Protein Families: Transmembrane