RUNX1T1 (NM_175635) Human Recombinant Protein
CAT#: TP322426
Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222426 representing NM_175635
Red=Cloning site Green=Tags(s) MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSS SLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPL RPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDR TKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRH PSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVK RQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCS GCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPS TIETTPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_783553 |
Locus ID | 862 |
UniProt ID | Q06455, W8FW32 |
Cytogenetics | 8q21.3 |
Refseq Size | 3233 |
Refseq ORF | 1701 |
Synonyms | AML1-MTG8; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2 |
Summary | This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
Protein Families | Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403575 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406255 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406277 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC430432 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403575 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3 |
USD 325.00 |
|
LY406255 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4 |
USD 325.00 |
|
LY406277 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
USD 495.00 |
|
LY430432 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
USD 325.00 |
|
PH300898 | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783554) |
USD 2,055.00 |
|
PH322426 | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553) |
USD 2,055.00 |
|
TP300898 | Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review