PLEKHO2 (NM_025201) Human Recombinant Protein

CAT#: TP323676

Recombinant protein of human pleckstrin homology domain containing, family O member 2 (PLEKHO2)

Product Images

Coomassie blue staining of purified PLEKHO2 protein (Cat# TP323676). The protein was produced from HEK293T cells transfected with PLEKHO2 cDNA clone (Cat# RC223676) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223676 representing NM_025201
  Red=Cloning site Green=Tags(s)
  
  MEEEGVKEAGEKPRGAQMVDKAGWIKKSSGGLLGFWKDRYLLLCQAQLLVYENEDDQKCVETVELGSYEK
  CQDLRALLKRKHRFILLRSPGNKVSDIKFQAPTGEEKESWIKALNEGINRGKNKAFDEVKVDKSCALEHV
  TRDRVRGGQRRRPPTRVHLKEVASAASDGLLRLDLDVPDSGPPVFAPSNHVSEAQPRETPRPLMPPTKPF
  LAPETTSPGDRVETPVGERAPTPVSASSEVSPESQEDSETPAEEDSGSEQPPNSVLPDKLKVSWENPSPQ
  EAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDDSP
  EPAKPSQAEGTPGTPPKDATTSTALPPWDLPPQFHPRCSSLGDLLGEGPRHPLQPRERLYRAQLEVKVAS
  EQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079477
• Locus ID: 80301
• UniProt ID: Q8TD55
• Cytogenetics: 15q22.31
• Refseq Size: 3675
• Refseq ORF: 1470
• Synonyms: PLEKHQ1; PP1628; pp9099
• Protein Families: Druggable Genome
• Protein Pathways: Cytokine-cytokine receptor interaction