FXYD6 (NM_001164832) Human Recombinant Protein
CAT#: TP328720
Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3.
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228720 protein sequence
Red=Cloning site Green=Tags(s) MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR APGDEEAQVENLITANATEPQKAEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001158304 |
Locus ID | 53826 |
UniProt ID | Q9H0Q3, A0A024R3J8 |
Cytogenetics | 11q23.3 |
Refseq Size | 2153 |
Refseq ORF | 285 |
Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411842 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431748 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431749 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431750 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431751 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411842 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
USD 325.00 |
|
LY431748 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3 |
USD 325.00 |
|
LY431749 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4 |
USD 325.00 |
|
LY431750 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 2 |
USD 325.00 |
|
LY431751 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 5 |
USD 325.00 |
|
PH310607 | FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286) |
USD 2,055.00 |
|
TP310607 | Recombinant protein of human FXYD domain containing ion transport regulator 6 (FXYD6) |
USD 823.00 |
|
TP328721 | Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review