PLGF (PGF) (NM_001207012) Human Recombinant Protein
CAT#: TP333309
Purified recombinant protein of Homo sapiens placental growth factor (PGF), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Other products for "PGF"
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC233309 protein sequence
Red=Cloning site Green=Tags(s) XCRS*GCSLASCSSWPGWRCLLCPPSSGPCLLGTARQRWKWYPSRKCGAAATAGRWRGWWTSCPSTPARW STCSAHPVSPCCAAPAAAAMRICTVCRWRRPMSPCSS*RSVLGTGPPTWS*RSLSTFAANAGLCGRR*SR KGAAMLFPG myc-FLAG tag |
| Tag | Myc-DDK |
| Predicted MW | 16.7 kDa |
| Concentration | >50 ug/mL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001193941 |
| Locus ID | 5228 |
| UniProt ID | P49763, Q86TW6 |
| Cytogenetics | 14q24.3 |
| Refseq Size | 1848 |
| Refseq ORF | 447 |
| Synonyms | D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760 |
| Summary | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China