EGF (NM_001963) Human Recombinant Protein
CAT#: TP720580
Purified recombinant protein of Human epidermal growth factor (EGF), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
|
Tag | Tag Free |
Predicted MW | 6.2 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 200mM NaCl, pH 7.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001954 |
Locus ID | 1950 |
UniProt ID | P01133 |
Cytogenetics | 4q25 |
Refseq Size | 5600 |
Refseq ORF | 3621 |
Synonyms | HOMG4; URG |
Summary | 'This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]' |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane |
Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Endocytosis, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419624 | EGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419624 | Transient overexpression lysate of epidermal growth factor (beta-urogastrone) (EGF) |
USD 325.00 |
|
PH310817 | EGF MS Standard C13 and N15-labeled recombinant protein (NP_001954) |
USD 2,055.00 |
|
TP310817 | Recombinant protein of human epidermal growth factor (beta-urogastrone) (EGF) |
USD 823.00 |
|
TP723068 | Purified recombinant protein of Human epidermal growth factor (EGF), transcript variant 1. |
USD 140.00 |
|
TP723821 | Purified recombinant protein of Human epidermal growth factor (EGF), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review