BMPR2 (NM_001204) Human Recombinant Protein

CAT#: TP720623

Purified recombinant protein of Human bone morphogenetic protein receptor, type II (serine/threonine kinase) (BMPR2)

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIVDHHHHHH
• Tag: C-His
• Predicted MW: 15.05 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001195
• Locus ID: 659
• UniProt ID: Q13873
• Cytogenetics: 2q33.1-q33.2
• Refseq Size: 12086
• Refseq ORF: 3114
• Synonyms: BMPR-II; BMPR3; BMR2; BRK-3; POVD1; PPH1; T-ALK
• Summary: 'This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Mutations in this gene have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease. [provided by RefSeq, May 2020]'
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, TGF-beta signaling pathway