uPA (PLAU) (NM_002658) Human Recombinant Protein

CAT#: TP720654

Purified recombinant protein of Human plasminogen activator, urokinase (PLAU), transcript variant 1

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALVDHHHHHH
• Tag: C-His
• Predicted MW: 47.41 kDa
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Supplied as a 0.2 µM filtered solution of 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 3 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002649
• Locus ID: 5328
• UniProt ID: P00749, Q59GZ8, A0A024QZM9
• Cytogenetics: 10q22.2
• Refseq Size: 2395
• Refseq ORF: 1293
• Synonyms: ATF; BDPLT5; QPD; u-PA; UPA; URK
• Summary: 'This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protease
• Protein Pathways: Complement and coagulation cascades