Interferon alpha 6 (IFNA6) (NM_021002) Human Recombinant Protein
CAT#: TP720705
Purified recombinant protein of Human interferon, alpha 6 (IFNA6)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH
|
Tag | C-His |
Predicted MW | 21.1 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_066282 |
Locus ID | 3443 |
UniProt ID | P05013 |
Cytogenetics | 9p21.3 |
Refseq Size | 570 |
Refseq ORF | 568 |
Synonyms | IFN-alphaK |
Summary | '' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412098 | IFNA6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412098 | Transient overexpression lysate of interferon, alpha 6 (IFNA6) |
USD 325.00 |
|
TP760235 | Recombinant protein of human interferon, alpha 6 (IFNA6), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP760329 | Purified recombinant protein of Homo sapiens interferon, alpha 6 (IFNA6), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review