ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein
CAT#: TP720708
Purified recombinant protein of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH
|
Tag | C-His |
Predicted MW | 16.98 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056997 |
Locus ID | 51060 |
UniProt ID | O95881 |
Cytogenetics | 1p32.3 |
Refseq Size | 2412 |
Refseq ORF | 516 |
Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19 |
Summary | This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glutathione metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414316 | TXNDC12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414316 | Transient overexpression lysate of thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
USD 325.00 |
|
PH303511 | TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) |
USD 2,055.00 |
|
TP303511 | Recombinant protein of human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review