ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein

CAT#: TP720708

Purified recombinant protein of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12)


  View other "TXNDC12" proteins (4)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "TXNDC12"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH
Tag C-His
Predicted MW 16.98 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_056997
Locus ID 51060
UniProt ID O95881
Cytogenetics 1p32.3
Refseq Size 2412
Refseq ORF 516
Synonyms AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19
Summary This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glutathione metabolism

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.