ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein
CAT#: TP303511
Recombinant protein of human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12)
View other "TXNDC12" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203511 protein sequence
Red=Cloning site Green=Tags(s) METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK ALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056997 |
Locus ID | 51060 |
UniProt ID | O95881 |
Cytogenetics | 1p32.3 |
Refseq Size | 2412 |
Refseq ORF | 516 |
Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19 |
Summary | This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glutathione metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414316 | TXNDC12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414316 | Transient overexpression lysate of thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
USD 396.00 |
|
PH303511 | TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) |
USD 2,055.00 |
|
TP720708 | Purified recombinant protein of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review