Catalase (CAT) (NM_001752) Human Recombinant Protein
CAT#: TP720852
Purified recombinant protein of Human catalase (CAT)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQ
|
Tag | Tag Free |
Predicted MW | 59.7 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001743 |
Locus ID | 847 |
UniProt ID | P04040, A0A384P5Q0 |
Cytogenetics | 11p13 |
Refseq Size | 2300 |
Refseq ORF | 1581 |
Synonyms | MGC138422; MGC138424 |
Summary | 'This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009]' |
Protein Families | Druggable Genome |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Metabolic pathways, Methane metabolism, Tryptophan metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419766 | CAT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419766 | Transient overexpression lysate of catalase (CAT) |
USD 325.00 |
|
PH310763 | CAT MS Standard C13 and N15-labeled recombinant protein (NP_001743) |
USD 2,055.00 |
|
TP310763 | Recombinant protein of human catalase (CAT) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review