MAP1LC3A (NM_032514) Human Recombinant Protein
CAT#: TP720854
Purified recombinant protein of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
|
Tag | C-His |
Predicted MW | 15.3 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115903 |
Locus ID | 84557 |
UniProt ID | Q9H492 |
Cytogenetics | 20q11.22 |
Refseq Size | 1048 |
Refseq ORF | 363 |
Synonyms | ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3 |
Summary | MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405680 | MAP1LC3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430540 | MAP1LC3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405680 | Transient overexpression lysate of microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 2 |
USD 325.00 |
|
LY430540 | Transient overexpression lysate of microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 2 |
USD 325.00 |
|
TP760032 | Recombinant protein of human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761490 | Purified recombinant protein of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review