MAP1LC3A (NM_032514) Human Recombinant Protein

CAT#: TP720854

Purified recombinant protein of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
• Tag: C-His
• Predicted MW: 15.3 kDa
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Supplied as a 0.2 µM filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 3 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115903
• Locus ID: 84557
• UniProt ID: Q9H492
• Cytogenetics: 20q11.22
• Refseq Size: 1048
• Refseq ORF: 363
• Synonyms: ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3
• Summary: MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012]