RPE (NM_199229) Human Recombinant Protein
CAT#: TP720894
Purified recombinant protein of Human ribulose-5-phosphate-3-epimerase (RPE), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH
|
Tag | C-His |
Predicted MW | 25.9 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 6.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_954699 |
Locus ID | 6120 |
UniProt ID | Q96AT9 |
Cytogenetics | 2q34 |
Refseq Size | 3265 |
Refseq ORF | 684 |
Synonyms | RPE2-1 |
Summary | '' |
Protein Pathways | Metabolic pathways, Pentose and glucuronate interconversions, Pentose phosphate pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404697 | RPE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416326 | RPE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404697 | Transient overexpression lysate of ribulose-5-phosphate-3-epimerase (RPE), transcript variant 1 |
USD 325.00 |
|
LY416326 | Transient overexpression lysate of ribulose-5-phosphate-3-epimerase (RPE), transcript variant 2 |
USD 325.00 |
|
PH300842 | RPE MS Standard C13 and N15-labeled recombinant protein (NP_954699) |
USD 2,055.00 |
|
TP300842 | Recombinant protein of human ribulose-5-phosphate-3-epimerase (RPE), transcript variant 1 |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review