UBE2C (NM_181801) Human Recombinant Protein
CAT#: TP720944
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MRGSHHHHHHGSMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
|
Tag | N-His |
Predicted MW | 23.3 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_861517 |
Locus ID | 11065 |
UniProt ID | O00762 |
Cytogenetics | 20q13.12 |
Refseq Size | 901 |
Refseq ORF | 540 |
Synonyms | dJ447F3.2; UBCH10 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405592 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416256 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405592 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 |
USD 325.00 |
|
LY416256 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 |
USD 325.00 |
|
PH300240 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_861517) |
USD 2,055.00 |
|
PH308741 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_008950) |
USD 2,055.00 |
|
TP300240 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 |
USD 823.00 |
|
TP308741 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 |
USD 823.00 |
|
TP312704 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 5 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review