Antibodies

View as table Download

Rabbit anti-UBE2C Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2C

UBE2C (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human UBE2C

Goat Anti-UBE2C / UBCH10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGDKGISAFPESDN, from the internal region of the protein sequence according to NP_008950.1; NP_861515.1; NP_861517.1.

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the N terminal of human UBE2C. Synthetic peptide located within the following region: ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2C Antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ

UBE2C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2C

UBE2C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Recombinant Anti-UBE2C (Clone SAIC-41A-1)

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated